Havano.nl SEO Analysis

Pagespeed Score
Desktop 99/100
Mobile 98/100
Optimization Stats
Field Data Result
Page Size 6 KB
Compression NO
Text/Html Ratio 708 / 6431 (bytes) = 11.01%
Load Time 0.48 second
Mobile Ready 0/100
In-Page Links 4
Doc Type XHTML 1.0 Transitional
Encoding ISO-8859-1
Declared Language Dutch
Preferred Domain Yes
Robots.txt No
Url Rewrite Yes
Underscores in url No
Images Without ALT 1 / 2
Embedded Objects (Desktop) No
Embedded Objects (Mobile) No
Iframe No
Custom 404 page No
Email Privacy No
Gsafe browsing Yes
Analytics No
W3C Validity No
Keyword Consistency
Keywords Freq Title Desc <H>
voor 2
       sparstraat 1
hier 1
utrecht- 1
care 1
studio 1
webdesign 1
ontwerp 1
grafisch 1
informatie 1
meer 1
projectstoffering  tapijtvinylegaliserenlaminaatparketmarmoleumzonweringslopenverhuizen  klik 1
woning- 1
havanovoor 1
   welkom 1
57/100
Update

December, 1 2023

With 0.48 seconds in page load, 6 KB of page size and all other reports below, the havano.nl has a SEO score of 57 out of 100

Meta tags data
Title HAVANO - woning- en projectstoffering - CBW-erkend - Utrecht
Description Woning- en Projectstoffering, Parket, Tapijt, Vinyl, Marmoleum, Laminaat, Zonwering, Egaliseren, Verhuizen
Keyword Woning- en Projectstoffering, Parket, Tapijt, Vinyl, Marmoleum, Laminaat, Zonwering, Egaliseren, Verhuizen
Domain Registration
Age 16 Years, 163 Days
Created 21st-Jun-2007
Updated 3rd-Oct-2022
Expiry N/a
DNS Data
Host Type Ttl Other
havano.nl A 290 ip:83.172.131.81
havano.nl NS 300 target:ns2.pleskserver1.nl
havano.nl NS 300 target:ns1.pleskserver1.nl
havano.nl SOA 300 mname:ns2.pleskserver1.nl
rname:servermeldingen.pleskserver1.nl
serial:2023100301
refresh:10800
retry:3600
expire:604800
minimum-ttl:10800
havano.nl MX 300 pri:10
target:mail.havano.nl
havano.nl TXT 300 txt:v=spf1 mx a ip4:83.172.131.81 ip6:2a02:cec0:10:b8::1 ip6:2a02:cec0:10:16::1 ip4:83.172.138.9 a:mail.havano.nl a:ns1.pleskserver1.nl include:relay.mailchannels.net ~all
http Headers
HTTP/1.1 301 Moved Permanently
Server: nginx
Date: Fri, 01 Dec 2023 13:47:50 GMT
Content-Type: text/html
Content-Length: 162
Connection: keep-alive
Location: https://havano.nl/

HTTP/2 200
server: nginx
date: Fri, 01 Dec 2023 13:47:50 GMT
content-type: text/html
content-length: 6431
last-modified: Wed, 16 Dec 2020 13:11:52 GMT
etag: "5fda0798-191f"
x-powered-by: PleskLin
accept-ranges: bytes


WHOIS Data
Domain name: havano.nl Status: active Registrar: Internet Service Europe B.V. Rucphensebaan 30A 4706PJ ROOSENDAAL Netherlands Abuse Contact: Creation Date: 2007-06-21 Updated Date: 2022-10-03 DNSSEC: no Domain nameservers: ns1.pleskserver1.nl ns2.pleskserver1.nl Record maintained by: SIDN BV Copyright notice No part of this publication may be reproduced, published, stored in a retrieval system, or transmitted, in any form or by any means, electronic, mechanical, recording, or otherwise, without prior permission of SIDN. These restrictions apply equally to registrars, except in that reproductions and publications are permitted insofar as they are reasonable, necessary and solely in the context of the registration activities referred to in the General Terms and Conditions for .nl Registrars. Any use of this material for advertising, targeting commercial offers or similar activities is explicitly forbidden and liable to result in legal action. Anyone who is aware or suspects that such activities are taking place is asked to inform SIDN. (c) SIDN BV, Dutch Copyright Act, protection of authors' rights (Section 10, subsection 1, clause 1).
Server Location
Server IP 83.172.131.81
Server Location Netherlands
Service Provider Eurofiber Cloud Infra B.V.
Domain Availability
Domains (TLD) Status
havano.com Already Registered
havano.net Already Registered
havano.org Already Registered
havano.biz Available
havano.io Already Registered
Typo Availability
Domains (TLD) Status
bavano.nl Already Registered
gavano.nl Already Registered
tavano.nl Already Registered
yavano.nl Already Registered
uavano.nl Available
Check More
Eriksatterautos.nl
Lametrofm.com
Optaresolutions.com
Afishman.com
Laevangelica.com
Centralohiosevereweathernetwork.org
Timewisevirtual.co.uk
Hirschenstammheim.ch
Pakistaniballs.com
Northescambia.com